PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g18390.1.p
Common NameBRADI_4g18390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 744aa    MW: 80505.7 Da    PI: 6.4284
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g18390.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS420.21.7e-1283787421374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal..ppsetseknsseelaalklfsevsPil 91 
                       lv+lLl+cA+ vs+gd+  a + L  l+  asp gd+mqR+a+yf+ ALaarla  +++ + +   +p + +   s ++l++++++++++P++
  Bradi4g18390.1.p 378 LVHLLLACADLVSKGDQPSALRHLHLLRRVASPLGDSMQRVASYFADALAARLALACPSSVVSPggAPFPFP--PSPDTLKIYQILYQACPYI 468
                       68****************************************************977766555513455554..599**************** PP

              GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                       kf+h+taNqaI ea++ge+rvH++D+di qG QWpa+lqaLa+Rp+gpp+lR+Tgvg+     + +++etg+ La++A++l+vpfef++ va+
  Bradi4g18390.1.p 469 KFAHFTANQAIFEAFQGEDRVHVVDLDILQGYQWPAFLQALAARPGGPPTLRLTGVGH----PAAAVRETGRHLASLAASLRVPFEFHAAVAD 557
                       **********************************************************....88***************************** PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       +le l++ +L+ + gEalaVn v +lhr++   ++l+     +L+++++  Pk++++veqea hn++ Fl rfleal+yysa+fdsl+a++p+
  Bradi4g18390.1.p 558 KLERLRPAALQRRVGEALAVNAVNRLHRVP--GAHLAP----LLSMIRDQAPKIMTLVEQEAGHNGPYFLGRFLEALHYYSAIFDSLDATFPA 644
                       *****************************9..555555....*************************************************** PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvs 369
                       +s  r+kvE+ ll++ei+nvvacegaer++rhe+l +Wr+ +e  GF++vpls  a+ q + ll  ++ +dgyr++e++g+l+lgW+dr+++ 
  Bradi4g18390.1.p 645 DSAPRMKVEQCLLAPEIRNVVACEGAERVARHERLDRWRRIMEGRGFEAVPLSPAAVGQSQVLLGLYGaGDGYRLNEDKGCLLLGWQDRAIIG 737
                       ********************************************************************************************* PP

              GRAS 370 vSaWr 374
                       +SaWr
  Bradi4g18390.1.p 738 ASAWR 742
                       ****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.67352721IPR005202Transcription factor GRAS
PfamPF035146.0E-126378742IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 744 aa     Download sequence    Send to blast
MCSRMGTLNC SDTTSSVKLQ QQQGPTSPTA SFSESNIVAS STDPDAIDAL AGLQALRFDG  60
DIDGEIQSPD LAMWESLFAD QIGASGADFL MSSPRRDFSP LRDFMVSSPK RDYMVSSPKR  120
DYMMSSPKRD YMMSSPKRDY MVSSPKREMG VSSPRRSTFS NLYSSTINQA NQQSYMHGME  180
GSPQTQYSNL ASQGNKGKSS PSPLHKVYIN NVNAHSNSGK SNGPSSLSCS SSYAHGENLP  240
LPSMDPFLEE YKEGYLAYQL PEKAGGSESA RTTAPTSSQL PTLSECLAMP EPGYGDGDDD  300
TAAAIVARAG IQVGGLQQTD HLYYASQFGA AEGSLSSLQH QMAKPEQWAD SSSLHSMLGS  360
VIQSEADQQQ EQDSGLQLVH LLLACADLVS KGDQPSALRH LHLLRRVASP LGDSMQRVAS  420
YFADALAARL ALACPSSVVS PGGAPFPFPP SPDTLKIYQI LYQACPYIKF AHFTANQAIF  480
EAFQGEDRVH VVDLDILQGY QWPAFLQALA ARPGGPPTLR LTGVGHPAAA VRETGRHLAS  540
LAASLRVPFE FHAAVADKLE RLRPAALQRR VGEALAVNAV NRLHRVPGAH LAPLLSMIRD  600
QAPKIMTLVE QEAGHNGPYF LGRFLEALHY YSAIFDSLDA TFPADSAPRM KVEQCLLAPE  660
IRNVVACEGA ERVARHERLD RWRRIMEGRG FEAVPLSPAA VGQSQVLLGL YGAGDGYRLN  720
EDKGCLLLGW QDRAIIGASA WRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-563787424375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014757818.10.0PREDICTED: DELLA protein GAI-like
TrEMBLA0A0Q3HJI10.0A0A0Q3HJI1_BRADI; Uncharacterized protein
STRINGBRADI4G18390.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92213141
Representative plantOGRP53661322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.14e-96RGA-like 1